Peptide cjc1295 With DAC raw materials powder cjc dac 1295 5mg 10mg CAS NO.863288-34-0 CAS NO.863288-34-0 cjc 1295 no dac CAS NO.863288-34-0
- FOB Price: USD: 90.00-170.00 /box Get Latest Price
- Min.Order: 1 box
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Available Specifications:
5mg(1-10)box10mg(1-10)box
- Product Details
Keywords
- cjc 1295 ipamorelin benefits
- cjc 1295 ipamorelin side effects
- cjc 1295 no dac
Quick Details
- ProName: CJC1295 10
- CasNo: 863288-34-0
- Molecular Formula: C152H252N44O42
- Appearance: Lyophilized powder
- Application: Lose weight
- DeliveryTime: 5-10
- PackAge: 10 vials per box
- Port: Shenzhen
- ProductionCapacity: 1000 box/Week
- Purity: 99%
- Storage: Double customs clearance. Cold chain t...
- Transportation: Cold chain transport
- LimitNum: 1 box
- cas: 863288-34-0
Superiority
Details
Product Name: | CJC1295 |
Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG) |
CAS: | 863288-34-0 |
MF: | C152H252N44O42 |
MW: | 3367.89688 |
EINECS: | 206-141-6 |
Product Categories: | Peptides;CJC;863288-34-0 |
Mol File: | 863288-34-0.mol |
CJC1295 Structure |
Key Specifications/ Special Features:
910463-68-2 lyophilized in Vials lose weight
Products details
picture
Why Choose Us
- High quality products: We have rich experience in production and processing, strict quality inspection.
- Reasonable prices: Factory direct, reasonable price and negotiable.
- Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
- Quick response: We will reply to your message within 24 hours.
- Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.
Shipping and Payment
Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods