Product Certification&
    Enterprise Certification

  • Mobile:
  • Tel:
  • Fax:+852 62341894
  • URL:http://hebeitaoshu.lookchem.com
  • Province/state:He Bei
  • City:Shijiazhuang
  • Street:15th floor, Block A, Wanda Plaza, Chang 'an District
  • MaxCard:
Home > Products >  98% Quality Protein Peptide Hormones 5Mg/vial White Cjc1295 Without Dac CAS 863288-34-0 CAS NO.863288-34-0 cjc 1295 benefits GLP-1 polypeptide lyophilized powder

98% Quality Protein Peptide Hormones 5Mg/vial White Cjc1295 Without Dac CAS 863288-34-0 CAS NO.863288-34-0 cjc 1295 benefits GLP-1 polypeptide lyophilized powder CAS NO.863288-34-0

  • FOB Price: USD: 90.00-170.00 /box Get Latest Price
  • Min.Order: 1 box
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Available Specifications:

    5mg(1-10)box10mg(1-10)box

  • Product Details

Keywords

  • cjc 1295 ipamorelin benefits GLP-1
  • cjc 1295 side effects lyophilized powder
  • CB01470921 polypeptide

Quick Details

  • ProName: CJC1295 23
  • CasNo: 863288-34-0
  • Molecular Formula: C152H252N44O42
  • Appearance: Lyophilized powder
  • Application: Lose weight
  • DeliveryTime: 5-10
  • PackAge: 10 vials per box
  • Port: Shenzhen
  • ProductionCapacity: 1000 box/Week
  • Purity: 99%
  • Storage: Double customs clearance. Cold chain t...
  • Transportation: Cold chain transport
  • LimitNum: 1 box
  • cas: 863288-34-0

Superiority

 

Details

Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
CAS: 863288-34-0
MF: C152H252N44O42
MW: 3367.89688
EINECS: 206-141-6
Product Categories: Peptides;CJC;863288-34-0
Mol File: 863288-34-0.mol
CJC1295 Structure

Key Specifications/ Special Features:

 


910463-68-2 lyophilized in Vials lose weight

Products details


picture

 

Why Choose Us

  • High quality products: We have rich experience in production and processing, strict quality inspection.
  • Reasonable prices: Factory direct, reasonable price and negotiable.
  • Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
  • Quick response: We will reply to your message within 24 hours.
  • Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

 

Shipping and Payment

 

Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog