China (Mainland)
Premiumsupplier 
Antibacterial Protein LL-37 (human) CAS NO.154947-66-7 LL-37 99%HPLC White powder ll 37 peptide CAS NO.154947-66-7
- FOB Price: USD: 80.00-80.00 /box Get Latest Price
- Min.Order: 1 box
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Available Specifications:
5mg(1-10)box
- Product Details
Keywords
- ll 37 peptide
- H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
- Antimicrobial Peptide
Quick Details
- ProName: LL-37 2
- CasNo: 154947-66-7
- Molecular Formula: C205H340N60O53
- Appearance: Lyophilized powder
- Application: Lose weight
- DeliveryTime: 5-10
- PackAge: 10 vials per box
- Port: Shenzhen
- ProductionCapacity: 1000 box/Week
- Purity: 99%
- Storage: Double customs clearance. Cold chain t...
- Transportation: Cold chain transport
- LimitNum: 1 box
- cas: 154947-66-7
Superiority
Details
| Product Name: | LL-37 |
| Synonyms: | Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate |
| CAS: | 154947-66-7 |
| MF: |
C205H340N60O53 |
| EINECS: | 211-519-9 |
Key Specifications/ Special Features:
154947-66-7 lyophilized in Vials lose weight
Products details
picture
Why Choose Us
- High quality products: We have rich experience in production and processing, strict quality inspection.
- Reasonable prices: Factory direct, reasonable price and negotiable.
- Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications
- Quick response: We will reply to your message within 24 hours.
- Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.
Shipping and Payment
Multiple delivery methods: support EXW, FOB, CIF, CFR and other delivery methods